- Recombinant Zea mays Cell number regulator 3 (CNR3)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1127062
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 18,223 Da
- E Coli or Yeast
- 1-167
- CNR3, ZmCNR03
- Cell number regulator 3 (CNR3)
Sequence
MYPATTPYETASGVGVAPVAGLFPVAGEAREWSSRLLDCFDDFDICCMTFWCPCITFGRTAEIVDHGMTSCGTSAALFALIQWLSGSQCTWAFSCTYRTRLRAQHGLPEAPCADFLVHLCCLHCALCQEYRELKARGYEPVLGWEFNAQRAAAGVAMCPPASQGMGR